The White Headstones Of Soldier Heroes In The Fort Boise Military Cemetery

byBlackBoxGuild

The white headstones of soldier heroes in the fort boise military cemetery in idaho - wide rolling

Format

4K, 1080

Frame Rate

23.98

Duration

0:05

Codec

h264

Keywords

boiseflagmistylandhillswwiisoldiersgravedeadmemorydefendersremembranceamericancountryfortheroesusagravestonesfightersmarkersoldsunsetheadstonesburiedlandscapelifemilitarydeathlandmarkhonorgrasswhitediedidahograsslandwindrespectkiapeacemountainspeoplesoldierafterlifepeacefulmemorialflagslivedcemeteryopen

Similar Videos

Headstones And American Flags At The Graveyard Of Fort Boise Military

4K   0:06

Flying Over A Soldier'S Final Resting Place During Sunset, Fort Boise

4K   0:05

Gravestones And Us Flags At The Fort Boise Military Cemetery In Boise

4K   0:10

Sunset Over Rosecrans Military Cemetery In San Diego, California. Camera

4K   0:08

Unknown Soldiers Gave Thier Lives And Were Laid To Rest At This Us World

4K   0:09

Row Of Gravestones Of Fallen Soldiers From World War One In Between

4K   0:12

Chateau Cemetery In Nice, France, Old Stone Crosses And Monuments Sequence

720   0:09

Old Stone Cross With Little Angel Sculpture At Chateau Cemetery In Nice, France

720   0:09

More By This Artist

Thunderstorm In Dark Sky Withing Clouds, Point Of View

4K   0:10

Silhouette Of Phone As Girl Browses Social Media On Smart Phone Late At

4K   0:23

Full Moon Rising At Halloween Witching Hour With Eerie Haunted Teal Green

4K   0:10

Cinematic Aerial Flight Through Cloudscape Showing Beautiful Mountain

4K   0:13

Flying Over A Canyon Wall Reveals Grand Junction Colorado

4K   0:20

Drone Flight Over Fall Forest In Canada. Autumn Leaves And Trees. Orange

4K   0:18

Waves Crashing On Beach With Sea Foam, Drone Birds Eye View

4K   0:13

New York City Central Park Helicopter Aerial

4K   0:14

Back
amobee