View Of The Famous Transfagarasan Road, In Romania. Best Mountain Road In

byBlackBoxGuild

View of the famous transfagarasan road, in romania. Best mountain road in the world. On a sunny summer day

Format

4K, 1080

Frame Rate

29.97

Duration

0:11

Codec

h264

Keywords

tripasphaltbicycletraffictourist7c4kcablecarcurtearomaniagrassgreentarmactopcablelakequietcurvecompetitionsummerbikeuhdtwistedtoursungroupraceinfomountainroadcarcablewaydangerfagarastransfagarasantransylvaniawarmmotorcyclegeardesibiuspeedtraveltourismargescautionviewtowerbusyaccident

Similar Videos

View Of The Well Known Transfagarasan Road, In Romania, On A Sunny Summer

4K   0:11

4K Couple In Car Driving Through Italian Town And Looking At Local Sights

4K   0:15

Inside Car View While Driving Through Woods

4K   0:17

Aerial View Of Passo Dello Stelvio Mountain Pass

4K   0:17

Time Lapse Sequence Of Passo Dello Stelvio Mountain Pass

4K   0:18

Chuya Highway With Traffic Cars And Mountains In Valley Of Altai

4K   0:31

Mountains Valley Of Altai With Traffic Cars On Chuya Highway And Katun River

4K   0:14

Vertical Panning Up Drone Shot While Drone Flying Backwards, Of A Mountain

4K   0:15

More By This Artist

Super 8Mm Film Burns, Dirt And Dust Overlay

4K   0:16

American Flag Blowing Majestically Against Blue Sky Slow Motion

4K   0:14

City Nighttime Drone Shot Over Street Congested With Car Traffic; Quito

4K   0:23

Close Up White Man On Bed Disapintment Shame Disgust Disdain Mad At Himself

4K   0:05

Crosswalk Timelapse From Drone Fly & Hyperlapse Of The Street

4K   0:20

Super 8Mm Film Burns, Dirt And Dust Overlay

4K   0:09

Cinematic Drone Shot Flying Slowly Over The Zambezi River In Zambia

1080   0:15

Flags Adorn Lawn, Americana Theme, July 4Th, Memorial Day, Veterans Day

4K   0:10

Back
amobee