Aerial View Of Passo Dello Stelvio Mountain Pass

byBlackBoxGuild

Aerial view of passo dello stelvio mountain pass

Format

4K, 1080

Frame Rate

23.98

Duration

0:17

Codec

mjpeg, h264

Keywords

roadalpscanyonmotorbikeaerialviewjourneyrockcarsnowtouristtravelplanetcyclingskyitalymountaintrafficscenicsnaturefamouscurvestreetbikestilfserlandscapescenerymotorcycleearthnationalfungiroditaliabuildingnatureeuropeanalpsexteriorsouthtirolparkbicycleasphaltplacehighupmountainpasssummerdrivingvalleypassodellostelviotiroljochaltoadigeitaly

Similar Videos

Time Lapse Sequence Of Passo Dello Stelvio Mountain Pass

4K   0:18

Road Bus Journey To Machu Picchu. Inside The Bus View

4K   0:20

Zlatibor, Serbia. Aerial View Of Gondola Route And Cabin Above Frozen Lake

4K   0:17

Aerial View Over Bridge At Sunset With Motorcycle Passing In Scene

4K   0:16

A Bus Journey In Andes Mountains To The Ruins Of Machu Picchu

4K   0:10

Aerial View Of The Road In Nubra Valley, With A Motorcycle Approaching

4K   0:14

Car Driving Along Alpine Tunnel In The Snow

4K   0:08

Aerial View Flying Backwards Over Forest At Dawn Towards Foggy Canyon

4K   0:20

More By This Artist

Super 8Mm Film Burns, Dirt And Dust Overlay

4K   0:16

American Flag Blowing Majestically Against Blue Sky Slow Motion

4K   0:14

City Nighttime Drone Shot Over Street Congested With Car Traffic; Quito

4K   0:23

Close Up White Man On Bed Disapintment Shame Disgust Disdain Mad At Himself

4K   0:05

Crosswalk Timelapse From Drone Fly & Hyperlapse Of The Street

4K   0:20

Super 8Mm Film Burns, Dirt And Dust Overlay

4K   0:09

Cinematic Drone Shot Flying Slowly Over The Zambezi River In Zambia

1080   0:15

Flags Adorn Lawn, Americana Theme, July 4Th, Memorial Day, Veterans Day

4K   0:10

Back
amobee