Two Policemen Wearing Face Mask Standing Next To A Police Car Parked On

byBlackBoxGuild

Editorial - two policemen wearing face mask standing next to a police car parked on sidewalk at night during pandemic. - wide shot

Format

4K, 1080

Frame Rate

29.97

Duration

0:07

Codec

h264

Keywords

guyprofessionalcovidcovid-19policeguardcoronatwilightstandcovid19peoplepatrolofficercoppolicemancitycoronaviruspoliceforcemanmasklawviruscareveningsheriffauthorityfacemaskpandemicfacesars-cov-2nighthatmobileoccupationservicejusticeenforcementsecurityuniformprotectionsafejobofficerparkarmedpersonprotectbadgesafetytraffic

Similar Videos

Guy Wearing Disposable Facemask At Beach During Covid - 19 Pandemic In Monte

1080   0:11

Corona Virus. Covid 19. A Guy Wearing The Mask And Feeling Really Lonely

4K   0:23

Covid - 19 Antigen Rapid Test Kit - Woman Unfolding And Reading The Manual

4K   0:24

White Guy In A Snowball Fight Throwing Snowballs With Ffp2 Face Mask On

4K   0:18

Woman Putting On Surgical Mask For Corona Virus Prevention

4K   0:06

Pilot Flying With Surgical Mask And Gloves, Corona Virus Protection

4K   0:20

Young Asian Man Wearing Facemask Due To Covid - 19 In Singapore. - Close Up

4K   0:05

Slow Motion Shot Of Female Latin Surgeon Administering New Covid - 19

4K   0:07

More By This Artist

Upset White Caucasian Man Facepalm On Bed Disapointed Frustrated

4K   0:07

City Nighttime Drone Shot Over Street Congested With Car Traffic; Quito

4K   0:23

Full Moon Rising At Halloween Witching Hour With Eerie Haunted Teal Green

4K   0:10

Mad Road Rage, Angry Latin Man On Traffic, Medium Static Shot

4K   0:10

Bald, Tan, Muscular, Bearded Man Pressing His Head Against A Filthy Mirror

4K   0:14

Bathing In The Twilight Of Northern California Beach Dark And Night Like

4K   0:22

Colorful And Retro Open - Plan Home Decoration With Brick Wall

1080   0:13

Latin Man In Ladder . Hispanic Repairman Checking Ceiling

4K   0:13

Back
amobee