Pretty Aerial Hoop Artist Spinning In Transition Between Dance Poses. Slow

byBlackBoxGuild

Pretty aerial hoop artist spinning in transition between dance poses. Slow motion outdoor shot

Format

4K, 1080

Frame Rate

23.98

Duration

0:10

Codec

prores, h264

Keywords

performanceaerialisthoopstrongdancerathletictreebalancemotionringeasternprofessionalslowyardfemininityspinninghangingflexiblebarefootgymnasticsstuntsbackwomansexycircusaerialacrobaticsposeoutdoormiddleacrobaticbodyfemaleperformerartistlifestyleflexibilitymuscularacrobat

Similar Videos

Acrobatic Dancer Balancing Herself On An Aerial Ring Hanging On Her Back

4K   0:15

Acrobatic Dancer Finishing A Sequence On A Hanging Hoop And Landing On The

1080   0:09

4K Female Breakdancer, In Slow Motion, Shot On Red Epic Dragon

4K   0:21

4K Female Breakdancer Freezes, In Slow Motion, Shot On Red Epic Dragon

4K   0:37

4K Flexible Breakdancer Dancing, In Slow Motion, Shot On Red Epic Dragon

4K   0:27

4K Flexible Breakdancer Is Triumphant, In Slow Motion, Shot On Red Epic Dragon

4K   0:35

4K Female Breakdancer Ends Her Dance, In Slow Motion, Shot On Red Epic Dragon

4K   0:38

4K Breakdancer Spins On Her Hands, In Slow Motion, Shot On Red Epic Dragon

4K   0:34

More By This Artist

Upset White Caucasian Man Facepalm On Bed Disapointed Frustrated

4K   0:07

City Nighttime Drone Shot Over Street Congested With Car Traffic; Quito

4K   0:23

Full Moon Rising At Halloween Witching Hour With Eerie Haunted Teal Green

4K   0:10

Mad Road Rage, Angry Latin Man On Traffic, Medium Static Shot

4K   0:10

Bald, Tan, Muscular, Bearded Man Pressing His Head Against A Filthy Mirror

4K   0:14

Bathing In The Twilight Of Northern California Beach Dark And Night Like

4K   0:22

Colorful And Retro Open - Plan Home Decoration With Brick Wall

1080   0:13

Latin Man In Ladder . Hispanic Repairman Checking Ceiling

4K   0:13

Back
amobee