Covid - 19 Antigen Rapid Test Kit - Woman Unfolding And Reading The Manual

byBlackBoxGuild

Covid-19 antigen rapid test kit - woman unfolding and reading the manual of self test kit for coronavirus. - close up

Format

4K, 1080

Frame Rate

50

Duration

0:24

Codec

h264

Keywords

covid-19tableunboxdiseaseinfectiousvaccinationtestunfoldinjectvariantpandemicguycovid19rdthousehomestrainmaskvariantrapidquarantinenovelsafetyantigenoutbreak2019-ncovinfectiouspersonmanualwomancoronaviruscovid-19readselfcoronadiagnostickitnewdiseaseselfsickhandmedicalvaccineboxrestrictiontestprecautioninjectionkitcovidsars-cov-2epidemicvirusnewlockdown

Similar Videos

Covid - 19 Drive - In Test Station In Klaipeda, Lithuania, Europe. Caucasian

4K   0:30

Tip Of Syringe Dripping Coronavirus Covid 19 Into Test Tube Vial. Vertical

4K   0:15

Nurse Injecting Coronavirus Vaccine Into Arm Of Patient. Vertical Video

4K   0:19

Macro Closeup Of Sterile Bag With Sars Covid Home Testing Equipment -

4K   0:11

Cinematic View Of An Asian Woman With Face Mask Making A Serious

4K   0:10

Covid - 19 Vaccine Public Safety Announcement. Center Zoom In On The Sign

1080   0:11

Person Pulled Covid - 19 Antigen Rapid Test Cassette Kit From Pouch. - Close

4K   0:14

Girl'S Hand Holding Covid - 19 Test Kit With Negative Result. - Close Up Shot

4K   0:05

More By This Artist

Upset White Caucasian Man Facepalm On Bed Disapointed Frustrated

4K   0:07

City Nighttime Drone Shot Over Street Congested With Car Traffic; Quito

4K   0:23

Full Moon Rising At Halloween Witching Hour With Eerie Haunted Teal Green

4K   0:10

Mad Road Rage, Angry Latin Man On Traffic, Medium Static Shot

4K   0:10

Bald, Tan, Muscular, Bearded Man Pressing His Head Against A Filthy Mirror

4K   0:14

Bathing In The Twilight Of Northern California Beach Dark And Night Like

4K   0:22

Colorful And Retro Open - Plan Home Decoration With Brick Wall

1080   0:13

Latin Man In Ladder . Hispanic Repairman Checking Ceiling

4K   0:13

Back
amobee